Lineage for d1eumf_ (1eum F:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46714Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 46818Protein Non-hem ferritin ecFtnA [63524] (1 species)
  7. 46819Species Escherichia coli [TaxId:562] [63525] (1 PDB entry)
  8. 46825Domain d1eumf_: 1eum F: [59512]

Details for d1eumf_

PDB Entry: 1eum (more details), 2.05 Å

PDB Description: crystal structure of the e.coli ferritin ecftna

SCOP Domain Sequences for d1eumf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eumf_ a.25.1.1 (F:) Non-hem ferritin ecFtnA {Escherichia coli}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstld

SCOP Domain Coordinates for d1eumf_:

Click to download the PDB-style file with coordinates for d1eumf_.
(The format of our PDB-style files is described here.)

Timeline for d1eumf_: