Lineage for d1eumb_ (1eum B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151501Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 151620Protein Non-hem ferritin [63524] (2 species)
  7. 151623Species Escherichia coli, FtnA [TaxId:562] [63525] (1 PDB entry)
  8. 151625Domain d1eumb_: 1eum B: [59508]

Details for d1eumb_

PDB Entry: 1eum (more details), 2.05 Å

PDB Description: crystal structure of the e.coli ferritin ecftna

SCOP Domain Sequences for d1eumb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eumb_ a.25.1.1 (B:) Non-hem ferritin {Escherichia coli, FtnA}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstld

SCOP Domain Coordinates for d1eumb_:

Click to download the PDB-style file with coordinates for d1eumb_.
(The format of our PDB-style files is described here.)

Timeline for d1eumb_: