![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (9 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (9 proteins) |
![]() | Protein Non-hem ferritin [63524] (4 species) |
![]() | Species Escherichia coli, FtnA [TaxId:562] [63525] (1 PDB entry) |
![]() | Domain d1euma_: 1eum A: [59507] |
PDB Entry: 1eum (more details), 2.05 Å
SCOP Domain Sequences for d1euma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq wyvseqheeeklfksiidklslagksgeglyfidkelstld
Timeline for d1euma_: