Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (7 species) |
Species Escherichia coli [TaxId:562] [54722] (11 PDB entries) |
Domain d1en6d2: 1en6 D:91-205 [59480] Other proteins in same PDB: d1en6a1, d1en6b1, d1en6c1, d1en6d1 complexed with mw1; mutant |
PDB Entry: 1en6 (more details), 2 Å
SCOP Domain Sequences for d1en6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1en6d2 d.44.1.1 (D:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanldspl mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk
Timeline for d1en6d2: