Lineage for d1en5d2 (1en5 D:91-205)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859482Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 859483Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 859484Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 859610Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 859628Species Escherichia coli [TaxId:562] [54722] (11 PDB entries)
  8. 859656Domain d1en5d2: 1en5 D:91-205 [59472]
    Other proteins in same PDB: d1en5a1, d1en5b1, d1en5c1, d1en5d1
    complexed with mw1; mutant

Details for d1en5d2

PDB Entry: 1en5 (more details), 2.3 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase y34f mutant
PDB Compounds: (D:) manganese superoxide dismutase

SCOP Domain Sequences for d1en5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en5d2 d.44.1.1 (D:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOP Domain Coordinates for d1en5d2:

Click to download the PDB-style file with coordinates for d1en5d2.
(The format of our PDB-style files is described here.)

Timeline for d1en5d2: