Lineage for d1el4a_ (1el4 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47635Protein Calcium-regulated photoprotein [47512] (3 species)
  7. 47638Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (2 PDB entries)
  8. 47639Domain d1el4a_: 1el4 A: [59453]

Details for d1el4a_

PDB Entry: 1el4 (more details), 1.73 Å

PDB Description: structure of the calcium-regulated photoprotein obelin determined by sulfur sas

SCOP Domain Sequences for d1el4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el4a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin}
sskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
krhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdi
fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
ldpeadglygngvp

SCOP Domain Coordinates for d1el4a_:

Click to download the PDB-style file with coordinates for d1el4a_.
(The format of our PDB-style files is described here.)

Timeline for d1el4a_: