Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries) |
Domain d1el1b1: 1el1 B:1-129 [59452] Other proteins in same PDB: d1el1a2, d1el1b2 holo-form complexed with ca |
PDB Entry: 1el1 (more details), 1.9 Å
SCOPe Domain Sequences for d1el1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1el1b1 d.2.1.2 (B:1-129) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]} kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifqln skwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkdl skylascnl
Timeline for d1el1b1: