Lineage for d1el1b1 (1el1 B:1-129)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2531389Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2531455Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2532447Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries)
  8. 2532452Domain d1el1b1: 1el1 B:1-129 [59452]
    Other proteins in same PDB: d1el1a2, d1el1b2
    holo-form
    complexed with ca

Details for d1el1b1

PDB Entry: 1el1 (more details), 1.9 Å

PDB Description: x-ray crystal structure analysis of canine milk lysozyme (holo-type)
PDB Compounds: (B:) Lysozyme C

SCOPe Domain Sequences for d1el1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el1b1 d.2.1.2 (B:1-129) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]}
kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifqln
skwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkdl
skylascnl

SCOPe Domain Coordinates for d1el1b1:

Click to download the PDB-style file with coordinates for d1el1b1.
(The format of our PDB-style files is described here.)

Timeline for d1el1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1el1b2