Lineage for d1el1b_ (1el1 B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 405486Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 405538Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 405752Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (3 PDB entries)
  8. 405755Domain d1el1b_: 1el1 B: [59452]
    holo-form
    complexed with ca

Details for d1el1b_

PDB Entry: 1el1 (more details), 1.9 Å

PDB Description: x-ray crystal structure analysis of canine milk lysozyme (holo-type)

SCOP Domain Sequences for d1el1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el1b_ d.2.1.2 (B:) Lysozyme {Dog (Canis familiaris), milk}
skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
lskylascnl

SCOP Domain Coordinates for d1el1b_:

Click to download the PDB-style file with coordinates for d1el1b_.
(The format of our PDB-style files is described here.)

Timeline for d1el1b_: