Lineage for d1el1a_ (1el1 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1013457Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1013515Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1013826Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries)
  8. 1013828Domain d1el1a_: 1el1 A: [59451]
    holo-form
    complexed with ca

Details for d1el1a_

PDB Entry: 1el1 (more details), 1.9 Å

PDB Description: x-ray crystal structure analysis of canine milk lysozyme (holo-type)
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1el1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el1a_ d.2.1.2 (A:) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]}
skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
lskylascnl

SCOPe Domain Coordinates for d1el1a_:

Click to download the PDB-style file with coordinates for d1el1a_.
(The format of our PDB-style files is described here.)

Timeline for d1el1a_: