![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries) |
![]() | Domain d1el1a1: 1el1 A:1-129 [59451] Other proteins in same PDB: d1el1a2, d1el1b2 holo-form complexed with ca |
PDB Entry: 1el1 (more details), 1.9 Å
SCOPe Domain Sequences for d1el1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1el1a1 d.2.1.2 (A:1-129) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]} kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifqln skwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkdl skylascnl
Timeline for d1el1a1: