Lineage for d1ek3b_ (1ek3 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1104358Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104474Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)
  8. 1104483Domain d1ek3b_: 1ek3 B: [59435]
    VL dimer of Bence-Jones protein REC
    complexed with ca, cl

Details for d1ek3b_

PDB Entry: 1ek3 (more details), 1.9 Å

PDB Description: kappa-4 immunoglobulin vl, rec
PDB Compounds: (B:) kappa-4 immunoglobulin light chain vl

SCOPe Domain Sequences for d1ek3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek3b_ b.1.1.1 (B:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr

SCOPe Domain Coordinates for d1ek3b_:

Click to download the PDB-style file with coordinates for d1ek3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ek3b_: