Lineage for d1eh4b_ (1eh4 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138074Protein Casein kinase-1, CK1 [56139] (2 species)
  7. 138075Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [56141] (3 PDB entries)
  8. 138079Domain d1eh4b_: 1eh4 B: [59413]

Details for d1eh4b_

PDB Entry: 1eh4 (more details), 2.8 Å

PDB Description: binary complex of casein kinase-1 from s. pombe with an atp competitive inhibitor, ic261

SCOP Domain Sequences for d1eh4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh4b_ d.144.1.1 (B:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe)}
nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll

SCOP Domain Coordinates for d1eh4b_:

Click to download the PDB-style file with coordinates for d1eh4b_.
(The format of our PDB-style files is described here.)

Timeline for d1eh4b_: