Lineage for d1eh4a_ (1eh4 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197201Family d.144.1.1: Serine/threonin kinases [56113] (18 proteins)
  6. 197231Protein Casein kinase-1, CK1 [56139] (2 species)
  7. 197232Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [56141] (3 PDB entries)
  8. 197235Domain d1eh4a_: 1eh4 A: [59412]

Details for d1eh4a_

PDB Entry: 1eh4 (more details), 2.8 Å

PDB Description: binary complex of casein kinase-1 from s. pombe with an atp competitive inhibitor, ic261

SCOP Domain Sequences for d1eh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh4a_ d.144.1.1 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe)}
nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll

SCOP Domain Coordinates for d1eh4a_:

Click to download the PDB-style file with coordinates for d1eh4a_.
(The format of our PDB-style files is described here.)

Timeline for d1eh4a_: