Lineage for d1eh4a_ (1eh4 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542771Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2542772Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [56141] (3 PDB entries)
  8. 2542775Domain d1eh4a_: 1eh4 A: [59412]
    complexed with ic1, so4

Details for d1eh4a_

PDB Entry: 1eh4 (more details), 2.8 Å

PDB Description: binary complex of casein kinase-1 from s. pombe with an atp competitive inhibitor, ic261
PDB Compounds: (A:) casein kinase-1

SCOPe Domain Sequences for d1eh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh4a_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll

SCOPe Domain Coordinates for d1eh4a_:

Click to download the PDB-style file with coordinates for d1eh4a_.
(The format of our PDB-style files is described here.)

Timeline for d1eh4a_: