SCOP 1.65: Domain d1ea8a_: 1ea8 A:

Lineage for d1ea8a_ (1ea8 A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.1: Apolipoprotein [47162] (1 family)

5. Family a.24.1.1: Apolipoprotein [47163] (1 protein)
   Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
   family may also include the five-helical bundle protein Apolipophorin-III

6. Protein Apolipoprotein E [88703] (3 species)

7. Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries)

8. Domain d1ea8a_: 1ea8 A: [59400]
   mutant

Details for d1ea8a_

PDB Entry: 1ea8, 1.95 Å

PDB Description: apolipoprotein e3 22kd fragment lys146glu mutant

SCOP Domain Sequences for d1ea8a_:

Sequence; same for both SEQRES and ATOM records:

>d1ea8a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrerllrdaddlqkrlavy

Timeline for d1ea8a_:

• d1ea8a_ first appeared in SCOP 1.57
  
• d1ea8a_ appears in SCOP 1.63
  
• d1ea8a_ appears in SCOP 1.67
  
• d1ea8a_ appears in the current release, SCOPe 2.08