Lineage for d1e9ma_ (1e9m A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 77921Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 77922Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (5 proteins)
  6. 77983Protein Ferredoxin VI [64229] (1 species)
  7. 77984Species Rhodobacter capsulatus [TaxId:1061] [64230] (1 PDB entry)
  8. 77985Domain d1e9ma_: 1e9m A: [59397]

Details for d1e9ma_

PDB Entry: 1e9m (more details), 2.07 Å

PDB Description: ferredoxin vi from rhodobacter capsulatus

SCOP Domain Sequences for d1e9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9ma_ d.15.4.1 (A:) Ferredoxin VI {Rhodobacter capsulatus}
akiifiehngtrheveakpgltvmeaardngvpgidadcggacacstchayvdpawvdkl
pkalptetdmidfayepnpatsrltcqikvtslldglvvhlpekqi

SCOP Domain Coordinates for d1e9ma_:

Click to download the PDB-style file with coordinates for d1e9ma_.
(The format of our PDB-style files is described here.)

Timeline for d1e9ma_: