Lineage for d1e8va_ (1e8v A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170568Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
  4. 170569Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 170570Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 170654Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species)
  7. 170655Species Newcastle disease virus [TaxId:11176] [63824] (3 PDB entries)
  8. 170658Domain d1e8va_: 1e8v A: [59391]

Details for d1e8va_

PDB Entry: 1e8v (more details), 2 Å

PDB Description: structure of the multifunctional paramyxovirus hemagglutinin- neuraminidase

SCOP Domain Sequences for d1e8va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8va_ b.68.1.1 (A:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus}
gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
siaeisntlfgefrivpllveilkndg

SCOP Domain Coordinates for d1e8va_:

Click to download the PDB-style file with coordinates for d1e8va_.
(The format of our PDB-style files is described here.)

Timeline for d1e8va_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e8vb_