Lineage for d1e8tb_ (1e8t B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114090Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
  4. 114091Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 114092Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 114173Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species)
  7. 114174Species Newcastle disease virus [TaxId:11176] [63824] (3 PDB entries)
  8. 114180Domain d1e8tb_: 1e8t B: [59388]

Details for d1e8tb_

PDB Entry: 1e8t (more details), 2.5 Å

PDB Description: structure of the multifunctional paramyxovirus hemagglutinin- neuraminidase

SCOP Domain Sequences for d1e8tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8tb_ b.68.1.1 (B:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus}
gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
siaeisntlfgefrivpllveilkndgvr

SCOP Domain Coordinates for d1e8tb_:

Click to download the PDB-style file with coordinates for d1e8tb_.
(The format of our PDB-style files is described here.)

Timeline for d1e8tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e8ta_