Lineage for d1e8cb2 (1e8c B:338-494)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143554Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 2143555Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 2143556Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 2143582Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [64107] (1 species)
  7. 2143583Species Escherichia coli [TaxId:562] [64108] (1 PDB entry)
  8. 2143585Domain d1e8cb2: 1e8c B:338-494 [59381]
    Other proteins in same PDB: d1e8ca1, d1e8ca3, d1e8ca4, d1e8cb1, d1e8cb3, d1e8cb4
    complexed with api, cl, uag

Details for d1e8cb2

PDB Entry: 1e8c (more details), 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli
PDB Compounds: (B:) udp-n-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase

SCOPe Domain Sequences for d1e8cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8cb2 c.59.1.1 (B:338-494) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}
vcgrmevftapgkptvvvdyahtpdalekalqaarlhcagklwcvfgcggdrdkgkrplm
gaiaeefadvavvtddnprteepraiindilagmldaghakvmegraeavtcavmqaken
dvvlvagkghedyqivgnqrldysdrvtvarllgvia

SCOPe Domain Coordinates for d1e8cb2:

Click to download the PDB-style file with coordinates for d1e8cb2.
(The format of our PDB-style files is described here.)

Timeline for d1e8cb2: