SCOPe 2.07: Domain d1e8cb1: 1e8c B:2-103

Lineage for d1e8cb1 (1e8c B:2-103)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.

4. Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (2 families)
   binds UDP group

5. Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins)

6. Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [63951] (1 species)

7. Species Escherichia coli [TaxId:562] [63952] (1 PDB entry)

8. Domain d1e8cb1: 1e8c B:2-103 [59380]
   Other proteins in same PDB: d1e8ca2, d1e8ca3, d1e8ca4, d1e8cb2, d1e8cb3, d1e8cb4
   complexed with api, cl, uag

Details for d1e8cb1

PDB Entry: 1e8c, 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli

PDB Compounds: (B:) udp-n-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase

SCOPe Domain Sequences for d1e8cb1:

Sequence; same for both SEQRES and ATOM records:

>d1e8cb1 c.98.1.1 (B:2-103) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}
drnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaa
iiaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhe

Timeline for d1e8cb1:

• d1e8cb1 first appeared in SCOP 1.57
  
• d1e8cb1 appears in SCOPe 2.06
  
• d1e8cb1 appears in the current release, SCOPe 2.08