Lineage for d1e7ta_ (1e7t A:)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145366Fold h.1: Parallel coiled-coil [57943] (21 superfamilies)
  4. 145847Superfamily h.1.20: Vimentin coil 2B fragment [64593] (1 family) (S)
  5. 145848Family h.1.20.1: Vimentin coil 2B fragment [64594] (1 protein)
  6. 145849Protein Vimentin coil 2B fragment [64595] (1 species)
  7. 145850Species Human (Homo sapiens) [TaxId:9606] [64596] (1 PDB entry)
  8. 145851Domain d1e7ta_: 1e7t A: [59371]

Details for d1e7ta_

PDB Entry: 1e7t (more details), 1.9 Å

PDB Description: human vimentin coil 2b fragment linked to gcn4 leucine zipper

SCOP Domain Sequences for d1e7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ta_ h.1.20.1 (A:) Vimentin coil 2B fragment {Human (Homo sapiens)}
mkqledkveellsknyhlenevarlkklvgdllnvkmaldieiatyrkllegees

SCOP Domain Coordinates for d1e7ta_:

Click to download the PDB-style file with coordinates for d1e7ta_.
(The format of our PDB-style files is described here.)

Timeline for d1e7ta_:

145851
d1e7ta_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1e7tb_