Lineage for d1e7ph1 (1e7p H:107-239)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 44793Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 44794Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein)
  6. 44795Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species)
  7. 44799Species Wolinella succinogenes [TaxId:844] [46552] (3 PDB entries)
  8. 44806Domain d1e7ph1: 1e7p H:107-239 [59362]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk2, d1e7pl_

Details for d1e7ph1

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1e7ph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ph1 a.1.2.1 (H:107-239) Fumarate reductase iron-sulfur protein, C-terminal domain {Wolinella succinogenes}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

SCOP Domain Coordinates for d1e7ph1:

Click to download the PDB-style file with coordinates for d1e7ph1.
(The format of our PDB-style files is described here.)

Timeline for d1e7ph1: