Lineage for d1e7pf_ (1e7p F:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201945Family f.2.1.9: Fumarate reductase respiratory complex transmembrane subunits [56910] (1 protein)
  6. 201946Protein Fumarate reductase respiratory complex transmembrane subunits [56911] (2 species)
  7. 201960Species Wolinella succinogenes [TaxId:844] [56913] (3 PDB entries)
  8. 201966Domain d1e7pf_: 1e7p F: [59358]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb1, d1e7pb2, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe1, d1e7pe2, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph1, d1e7ph2, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk1, d1e7pk2

Details for d1e7pf_

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1e7pf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pf_ f.2.1.9 (F:) Fumarate reductase respiratory complex transmembrane subunits {Wolinella succinogenes}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrth

SCOP Domain Coordinates for d1e7pf_:

Click to download the PDB-style file with coordinates for d1e7pf_.
(The format of our PDB-style files is described here.)

Timeline for d1e7pf_: