Lineage for d1e7da_ (1e7d A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77113Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
  4. 77114Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) (S)
  5. 77153Family d.4.1.4: Recombination endonuclease VII [54072] (1 protein)
  6. 77154Protein Recombination endonuclease VII [54073] (1 species)
  7. 77155Species Bacteriophage T4 [TaxId:10665] [54074] (3 PDB entries)
  8. 77160Domain d1e7da_: 1e7d A: [59342]

Details for d1e7da_

PDB Entry: 1e7d (more details), 2.8 Å

PDB Description: endonuclease vii (endovii) ffrom phage t4

SCOP Domain Sequences for d1e7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7da_ d.4.1.4 (A:) Recombination endonuclease VII {Bacteriophage T4}
mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
keemmaemlqrgfeynesdtktqliasfkkqlrkslk

SCOP Domain Coordinates for d1e7da_:

Click to download the PDB-style file with coordinates for d1e7da_.
(The format of our PDB-style files is described here.)

Timeline for d1e7da_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e7db_