Lineage for d1e6zb3 (1e6z B:292-379)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548924Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2548925Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2548984Protein Chitinase B [54560] (1 species)
  7. 2548985Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries)
  8. 2549017Domain d1e6zb3: 1e6z B:292-379 [59335]
    Other proteins in same PDB: d1e6za1, d1e6za2, d1e6zb1, d1e6zb2
    complexed with nag, ngo, so4

Details for d1e6zb3

PDB Entry: 1e6z (more details), 1.99 Å

PDB Description: chitinase b from serratia marcescens wildtype in complex with catalytic intermediate
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1e6zb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6zb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOPe Domain Coordinates for d1e6zb3:

Click to download the PDB-style file with coordinates for d1e6zb3.
(The format of our PDB-style files is described here.)

Timeline for d1e6zb3: