Lineage for d1e6pa3 (1e6p A:292-379)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2186175Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2186176Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2186235Protein Chitinase B [54560] (1 species)
  7. 2186236Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries)
  8. 2186241Domain d1e6pa3: 1e6p A:292-379 [59316]
    Other proteins in same PDB: d1e6pa1, d1e6pa2, d1e6pb1, d1e6pb2
    complexed with gol, so4; mutant

Details for d1e6pa3

PDB Entry: 1e6p (more details), 1.7 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1e6pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6pa3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOPe Domain Coordinates for d1e6pa3:

Click to download the PDB-style file with coordinates for d1e6pa3.
(The format of our PDB-style files is described here.)

Timeline for d1e6pa3: