Lineage for d1e6nb2 (1e6n B:3-291,B:380-446)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 65132Family c.1.8.5: Type II chitinase [51534] (7 proteins)
  6. 65143Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 65144Species Serratia marcescens [TaxId:615] [51547] (5 PDB entries)
  8. 65152Domain d1e6nb2: 1e6n B:3-291,B:380-446 [59312]
    Other proteins in same PDB: d1e6na1, d1e6na3, d1e6nb1, d1e6nb3

Details for d1e6nb2

PDB Entry: 1e6n (more details), 2.25 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q in complex with n-acetylglucosamine-pentamer

SCOP Domain Sequences for d1e6nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6nb2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvdidwqypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOP Domain Coordinates for d1e6nb2:

Click to download the PDB-style file with coordinates for d1e6nb2.
(The format of our PDB-style files is described here.)

Timeline for d1e6nb2: