Lineage for d1e6na3 (1e6n A:292-379)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79020Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 79105Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 79106Family d.26.3.1: Chitinase insertion domain [54557] (4 proteins)
  6. 79117Protein Chitinase B [54560] (1 species)
  7. 79118Species Serratia marcescens [TaxId:615] [54561] (5 PDB entries)
  8. 79125Domain d1e6na3: 1e6n A:292-379 [59310]
    Other proteins in same PDB: d1e6na1, d1e6na2, d1e6nb1, d1e6nb2

Details for d1e6na3

PDB Entry: 1e6n (more details), 2.25 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q in complex with n-acetylglucosamine-pentamer

SCOP Domain Sequences for d1e6na3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6na3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgcaecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1e6na3:

Click to download the PDB-style file with coordinates for d1e6na3.
(The format of our PDB-style files is described here.)

Timeline for d1e6na3: