Lineage for d1e6ec2 (1e6e C:5-106,C:332-460)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850289Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2850290Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2850291Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 2850295Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species)
  7. 2850296Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries)
  8. 2850301Domain d1e6ec2: 1e6e C:5-106,C:332-460 [59302]
    Other proteins in same PDB: d1e6ea1, d1e6eb_, d1e6ec1, d1e6ed_
    complexed with fad, fes, so4

Details for d1e6ec2

PDB Entry: 1e6e (more details), 2.3 Å

PDB Description: adrenodoxin reductase/adrenodoxin complex of mitochondrial p450 systems
PDB Compounds: (C:) nadph:adrenodoxin oxidoreductase

SCOPe Domain Sequences for d1e6ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ec2 c.4.1.1 (C:5-106,C:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}
qtpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvint
ftqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgv
vpnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsa
fikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh

SCOPe Domain Coordinates for d1e6ec2:

Click to download the PDB-style file with coordinates for d1e6ec2.
(The format of our PDB-style files is described here.)

Timeline for d1e6ec2: