Lineage for d1e6ea2 (1e6e A:4-106,A:332-460)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176615Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 176616Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
  5. 176617Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (4 proteins)
  6. 176618Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species)
  7. 176619Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries)
  8. 176623Domain d1e6ea2: 1e6e A:4-106,A:332-460 [59299]
    Other proteins in same PDB: d1e6ea1, d1e6eb_, d1e6ec1, d1e6ed_

Details for d1e6ea2

PDB Entry: 1e6e (more details), 2.3 Å

PDB Description: adrenodoxin reductase/adrenodoxin complex of mitochondrial p450 systems

SCOP Domain Sequences for d1e6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ea2 c.4.1.1 (A:4-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)}
eqtpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvin
tftqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklg
vvpnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgs
afikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh

SCOP Domain Coordinates for d1e6ea2:

Click to download the PDB-style file with coordinates for d1e6ea2.
(The format of our PDB-style files is described here.)

Timeline for d1e6ea2: