Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) |
Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) |
Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (3 proteins) |
Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries) |
Domain d1e6ea2: 1e6e A:4-106,A:332-460 [59299] Other proteins in same PDB: d1e6ea1, d1e6eb_, d1e6ec1, d1e6ed_ |
PDB Entry: 1e6e (more details), 2.3 Å
SCOP Domain Sequences for d1e6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6ea2 c.4.1.1 (A:4-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)} eqtpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvin tftqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklg vvpnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgs afikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh
Timeline for d1e6ea2:
View in 3D Domains from other chains: (mouse over for more information) d1e6eb_, d1e6ec1, d1e6ec2, d1e6ed_ |