SCOP 1.67: Domain d1e6ba2: 1e6b A:8-87

Lineage for d1e6ba2 (1e6b A:8-87)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class zeta GST [81364] (2 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [64059] (1 PDB entry)

8. Domain d1e6ba2: 1e6b A:8-87 [59295]
   Other proteins in same PDB: d1e6ba1
   complexed with bme

Details for d1e6ba2

PDB Entry: 1e6b, 1.65 Å

PDB Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana

SCOP Domain Sequences for d1e6ba2:

Sequence; same for both SEQRES and ATOM records:

>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana)}
klklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtvpalvdgd
vvindsfaiimyldekypep

Timeline for d1e6ba2:

• d1e6ba2 first appeared in SCOP 1.57
  
• d1e6ba2 appears in SCOP 1.65
  
• d1e6ba2 appears in SCOP 1.69
  
• d1e6ba2 appears in the current release, SCOPe 2.08