Lineage for d1e6ba2 (1e6b A:8-87)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315468Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 315804Protein Class zeta GST [81364] (2 species)
  7. 315807Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [64059] (1 PDB entry)
  8. 315808Domain d1e6ba2: 1e6b A:8-87 [59295]
    Other proteins in same PDB: d1e6ba1
    complexed with bme

Details for d1e6ba2

PDB Entry: 1e6b (more details), 1.65 Å

PDB Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana

SCOP Domain Sequences for d1e6ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana)}
klklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtvpalvdgd
vvindsfaiimyldekypep

SCOP Domain Coordinates for d1e6ba2:

Click to download the PDB-style file with coordinates for d1e6ba2.
(The format of our PDB-style files is described here.)

Timeline for d1e6ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6ba1