Lineage for d1e6ba2 (1e6b A:8-87)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181222Species Mouse-ear cress (Arabidopsis thaliana), class zeta [64059] (1 PDB entry)
  8. 181223Domain d1e6ba2: 1e6b A:8-87 [59295]
    Other proteins in same PDB: d1e6ba1

Details for d1e6ba2

PDB Entry: 1e6b (more details), 1.65 Å

PDB Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana

SCOP Domain Sequences for d1e6ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ba2 c.47.1.5 (A:8-87) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana), class zeta}
klklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtvpalvdgd
vvindsfaiimyldekypep

SCOP Domain Coordinates for d1e6ba2:

Click to download the PDB-style file with coordinates for d1e6ba2.
(The format of our PDB-style files is described here.)

Timeline for d1e6ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6ba1