SCOP 1.63: Domain d1e6ba1: 1e6b A:88-220

Lineage for d1e6ba1 (1e6b A:88-220)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class zeta GST [81353] (2 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [63556] (1 PDB entry)

8. Domain d1e6ba1: 1e6b A:88-220 [59294]
   Other proteins in same PDB: d1e6ba2
   complexed with bme

Details for d1e6ba1

PDB Entry: 1e6b, 1.65 Å

PDB Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana

SCOP Domain Sequences for d1e6ba1:

Sequence, based on SEQRES records:

>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana)}
pllprdlhkravnyqamsivlsgiqphqnlaviryieekinveektawvnnaitkgftal
ekllvncagkhatgdeiyladlflapqihgainrfqinmepyptlakcyesynelpafqn
alpekqpdapsst

Sequence, based on observed residues (ATOM records):

>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana)}
pllprdlhkravnyqamsivlsgiqptawvnnaitkgftalekllvncagkhatgdeiyl
adlflapqihgainrfqinmepyptlakcyesynelpafqnalpekqpdapsst

Timeline for d1e6ba1:

• d1e6ba1 first appeared in SCOP 1.57
  
• d1e6ba1 appears in SCOP 1.61
  
• d1e6ba1 appears in SCOP 1.65
  
• d1e6ba1 appears in the current release, SCOPe 2.08