Lineage for d1e6ba1 (1e6b A:88-220)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153288Species Mouse-ear cress (Arabidopsis thaliana), class zeta [63556] (1 PDB entry)
  8. 153289Domain d1e6ba1: 1e6b A:88-220 [59294]
    Other proteins in same PDB: d1e6ba2

Details for d1e6ba1

PDB Entry: 1e6b (more details), 1.65 Å

PDB Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana

SCOP Domain Sequences for d1e6ba1:

Sequence, based on SEQRES records: (download)

>d1e6ba1 a.45.1.1 (A:88-220) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana), class zeta}
pllprdlhkravnyqamsivlsgiqphqnlaviryieekinveektawvnnaitkgftal
ekllvncagkhatgdeiyladlflapqihgainrfqinmepyptlakcyesynelpafqn
alpekqpdapsst

Sequence, based on observed residues (ATOM records): (download)

>d1e6ba1 a.45.1.1 (A:88-220) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana), class zeta}
pllprdlhkravnyqamsivlsgiqptawvnnaitkgftalekllvncagkhatgdeiyl
adlflapqihgainrfqinmepyptlakcyesynelpafqnalpekqpdapsst

SCOP Domain Coordinates for d1e6ba1:

Click to download the PDB-style file with coordinates for d1e6ba1.
(The format of our PDB-style files is described here.)

Timeline for d1e6ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6ba2