Lineage for d1e4xm2 (1e4x M:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656221Domain d1e4xm2: 1e4x M:108-214 [59243]
    Other proteins in same PDB: d1e4xh1, d1e4xh2, d1e4xi1, d1e4xi2, d1e4xl1, d1e4xm1
    part of anti-TGFalpha Fab TAB2

Details for d1e4xm2

PDB Entry: 1e4x (more details), 1.9 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
PDB Compounds: (M:) tab2

SCOP Domain Sequences for d1e4xm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4xm2 b.1.1.2 (M:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1e4xm2:

Click to download the PDB-style file with coordinates for d1e4xm2.
(The format of our PDB-style files is described here.)

Timeline for d1e4xm2: