Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries) |
Domain d1e4xm2: 1e4x M:108-214 [59243] Other proteins in same PDB: d1e4xh1, d1e4xh2, d1e4xi1, d1e4xi2, d1e4xl1, d1e4xm1 part of anti-TGFalpha Fab TAB2 |
PDB Entry: 1e4x (more details), 1.9 Å
SCOP Domain Sequences for d1e4xm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4xm2 b.1.1.2 (M:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1e4xm2: