SCOP 1.71: Domain d1e4xm2: 1e4x M:108-214

Lineage for d1e4xm2 (1e4x M:108-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d1e4xm2: 1e4x M:108-214 [59243]
   Other proteins in same PDB: d1e4xh1, d1e4xh2, d1e4xi1, d1e4xi2, d1e4xl1, d1e4xm1
   part of anti-TGFalpha Fab TAB2

Details for d1e4xm2

PDB Entry: 1e4x, 1.9 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

SCOP Domain Sequences for d1e4xm2:

Sequence; same for both SEQRES and ATOM records:

>d1e4xm2 b.1.1.2 (M:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1e4xm2:

• d1e4xm2 first appeared in SCOP 1.57
  
• d1e4xm2 appears in SCOP 1.69
  
• d1e4xm2 appears in SCOP 1.73
  
• d1e4xm2 appears in the current release, SCOPe 2.08