![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
![]() | Domain d1e4xi2: 1e4x I:111-213 [59239] Other proteins in same PDB: d1e4xh1, d1e4xi1, d1e4xl1, d1e4xl2, d1e4xm1, d1e4xm2 part of anti-TGFalpha Fab TAB2 |
PDB Entry: 1e4x (more details), 1.9 Å
SCOP Domain Sequences for d1e4xi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4xi2 b.1.1.2 (I:111-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprvpi
Timeline for d1e4xi2: