SCOP 1.57: Domain d1e4xi2: 1e4x I:111-213

Lineage for d1e4xi2 (1e4x I:111-213)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Anti-TGFalpha Fab TAB2, (mouse), kappa L chain [63656] (2 PDB entries)

8. Domain d1e4xi2: 1e4x I:111-213 [59239]
   Other proteins in same PDB: d1e4xh1, d1e4xi1, d1e4xl1, d1e4xm1

Details for d1e4xi2

PDB Entry: 1e4x, 1.9 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

SCOP Domain Sequences for d1e4xi2:

Sequence; same for both SEQRES and ATOM records:

>d1e4xi2 b.1.1.2 (I:111-213) Immunoglobulin (constant domains of L and H chains) {Anti-TGFalpha Fab TAB2, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprvpi

Timeline for d1e4xi2:

• d1e4xi2 is new in SCOP 1.57
  
• d1e4xi2 appears in SCOP 1.59
  
• d1e4xi2 appears in the current release, SCOPe 2.08