![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
![]() | Species Anti-TGFalpha Fab TAB2, (mouse), kappa L chain [63656] (2 PDB entries) |
![]() | Domain d1e4xi2: 1e4x I:111-213 [59239] Other proteins in same PDB: d1e4xh1, d1e4xi1, d1e4xl1, d1e4xm1 |
PDB Entry: 1e4x (more details), 1.9 Å
SCOP Domain Sequences for d1e4xi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4xi2 b.1.1.2 (I:111-213) Immunoglobulin (constant domains of L and H chains) {Anti-TGFalpha Fab TAB2, (mouse), kappa L chain} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprvpi
Timeline for d1e4xi2: