Lineage for d1e4xi1 (1e4x I:1-110)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102176Species Anti-TGFalpha Fab TAB2, (mouse), kappa L chain [63644] (2 PDB entries)
  8. 102180Domain d1e4xi1: 1e4x I:1-110 [59238]
    Other proteins in same PDB: d1e4xh2, d1e4xi2, d1e4xl2, d1e4xm2

Details for d1e4xi1

PDB Entry: 1e4x (more details), 1.9 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

SCOP Domain Sequences for d1e4xi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4xi1 b.1.1.1 (I:1-110) Immunoglobulin (variable domains of L and H chains) {Anti-TGFalpha Fab TAB2, (mouse), kappa L chain}
qvqlqqpgaelvkpgpsvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvss

SCOP Domain Coordinates for d1e4xi1:

Click to download the PDB-style file with coordinates for d1e4xi1.
(The format of our PDB-style files is described here.)

Timeline for d1e4xi1: