Lineage for d1e4xh1 (1e4x H:1-110)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219198Species Anti-TGFalpha Fab TAB2, (mouse), kappa L chain [63644] (2 PDB entries)
  8. 219201Domain d1e4xh1: 1e4x H:1-110 [59236]
    Other proteins in same PDB: d1e4xh2, d1e4xi2, d1e4xl2, d1e4xm2

Details for d1e4xh1

PDB Entry: 1e4x (more details), 1.9 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

SCOP Domain Sequences for d1e4xh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4xh1 b.1.1.1 (H:1-110) Immunoglobulin (variable domains of L and H chains) {Anti-TGFalpha Fab TAB2, (mouse), kappa L chain}
qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvss

SCOP Domain Coordinates for d1e4xh1:

Click to download the PDB-style file with coordinates for d1e4xh1.
(The format of our PDB-style files is described here.)

Timeline for d1e4xh1: