Lineage for d1e4xh1 (1e4x H:6-110)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. Domain d1e4xh1: 1e4x H:6-110 [59236]
    Other proteins in same PDB: d1e4xh2, d1e4xh3, d1e4xi2, d1e4xi3, d1e4xl1, d1e4xl2, d1e4xm1, d1e4xm2
    part of anti-TGFalpha Fab TAB2

Details for d1e4xh1

PDB Entry: 1e4x (more details), 1.9 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
PDB Compounds: (H:) tab2

SCOPe Domain Sequences for d1e4xh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4xh1 b.1.1.1 (H:6-110) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtnynekfk
tkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvss

SCOPe Domain Coordinates for d1e4xh1 are not available.

Timeline for d1e4xh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4xh2, d1e4xh3
View in 3D
Domains from other chains:
(mouse over for more information)
d1e4xi1, d1e4xi2, d1e4xi3, d1e4xl1, d1e4xl2, d1e4xm1, d1e4xm2