Lineage for d1e4wl2 (1e4w L:108-214)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159406Species Anti-TGFalpha Fab TAB2, (mouse), kappa L chain [63656] (2 PDB entries)
  8. 159408Domain d1e4wl2: 1e4w L:108-214 [59235]
    Other proteins in same PDB: d1e4wh1, d1e4wl1

Details for d1e4wl2

PDB Entry: 1e4w (more details), 1.95 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

SCOP Domain Sequences for d1e4wl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4wl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-TGFalpha Fab TAB2, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1e4wl2:

Click to download the PDB-style file with coordinates for d1e4wl2.
(The format of our PDB-style files is described here.)

Timeline for d1e4wl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4wl1