SCOP 1.73: Domain d1e4wl1: 1e4w L:1-107

Lineage for d1e4wl1 (1e4w L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1e4wl1: 1e4w L:1-107 [59234]
   Other proteins in same PDB: d1e4wh1, d1e4wh2, d1e4wl2
   part of anti-TGFalpha Fab TAB2
   complexed with cl, ni

Details for d1e4wl1

PDB Entry: 1e4w, 1.95 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

PDB Compounds: (L:) tab2

SCOP Domain Sequences for d1e4wl1:

Sequence; same for both SEQRES and ATOM records:

>d1e4wl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqtpsslsaslgdrvtiscrasqdishylnwfqqkpdgtvklliyytstlhsgvps
rfsgsgsgtdysltisnleeediafyfcqqggalpftfgsgtklaik

Timeline for d1e4wl1:

• d1e4wl1 first appeared in SCOP 1.57
  
• d1e4wl1 appears in SCOP 1.71
  
• d1e4wl1 appears in SCOP 1.75
  
• d1e4wl1 appears in the current release, SCOPe 2.08