SCOP 1.63: Domain d1e4wl1: 1e4w L:1-107

Lineage for d1e4wl1 (1e4w L:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-TGFalpha Fab TAB2, (mouse), kappa L chain [63644] (2 PDB entries)

8. Domain d1e4wl1: 1e4w L:1-107 [59234]
   Other proteins in same PDB: d1e4wh2, d1e4wl2

Details for d1e4wl1

PDB Entry: 1e4w, 1.95 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

SCOP Domain Sequences for d1e4wl1:

Sequence; same for both SEQRES and ATOM records:

>d1e4wl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-TGFalpha Fab TAB2, (mouse), kappa L chain}
diqmtqtpsslsaslgdrvtiscrasqdishylnwfqqkpdgtvklliyytstlhsgvps
rfsgsgsgtdysltisnleeediafyfcqqggalpftfgsgtklaik

Timeline for d1e4wl1:

• d1e4wl1 first appeared in SCOP 1.57
  
• d1e4wl1 appears in SCOP 1.61
  
• d1e4wl1 appears in SCOP 1.65
  
• d1e4wl1 appears in the current release, SCOPe 2.08