SCOP 1.71: Domain d1e4wh2: 1e4w H:111-209

Lineage for d1e4wh2 (1e4w H:111-209)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1e4wh2: 1e4w H:111-209 [59233]
   Other proteins in same PDB: d1e4wh1, d1e4wl1, d1e4wl2
   part of anti-TGFalpha Fab TAB2
   complexed with cl, ni

Details for d1e4wh2

PDB Entry: 1e4w, 1.95 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

SCOP Domain Sequences for d1e4wh2:

Sequence; same for both SEQRES and ATOM records:

>d1e4wh2 b.1.1.2 (H:111-209) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1e4wh2:

• d1e4wh2 first appeared in SCOP 1.57
  
• d1e4wh2 appears in SCOP 1.69
  
• d1e4wh2 appears in SCOP 1.73
  
• d1e4wh2 appears in the current release, SCOPe 2.08