Lineage for d1e4wh1 (1e4w H:1-110)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652598Domain d1e4wh1: 1e4w H:1-110 [59232]
    Other proteins in same PDB: d1e4wh2, d1e4wl1, d1e4wl2
    part of anti-TGFalpha Fab TAB2
    complexed with cl, ni

Details for d1e4wh1

PDB Entry: 1e4w (more details), 1.95 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
PDB Compounds: (H:) tab2

SCOP Domain Sequences for d1e4wh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4wh1 b.1.1.1 (H:1-110) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvss

SCOP Domain Coordinates for d1e4wh1:

Click to download the PDB-style file with coordinates for d1e4wh1.
(The format of our PDB-style files is described here.)

Timeline for d1e4wh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4wh2