Lineage for d1e3xa2 (1e3x A:1-393)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438625Protein Bacterial alpha-amylase [51447] (10 species)
  7. 2438655Species Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId:1390] [63903] (4 PDB entries)
    the N-terminal 300 residues are from B. amyloliquefaciens
  8. 2438657Domain d1e3xa2: 1e3x A:1-393 [59212]
    Other proteins in same PDB: d1e3xa1
    complexed with ca, na

Details for d1e3xa2

PDB Entry: 1e3x (more details), 1.9 Å

PDB Description: native structure of chimaeric amylase from b. amyloliquefaciens and b. licheniformis at 1.92a
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1e3xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3xa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]}
vngtlmqyfewytpndgqhwkrlqndaehlsdigitavwippaykglsqsdngygpydly
dlgefqqkgtvrtkygtkselqdaigslhsrnvqvygdvvlnhkagadatedvtavevnp
anrnqetseeyqikawtdfrfpgrgntysdfkwhwyhfdgadwdesrkisrifkfrgegk
awdwevssengnydylmyadvdydhpdvvaetkkwgiwyanelsldgfridaakhikfsf
lrdwvqavrqatgkemftvaeywqnnagklenylnktsfnqsvfdvplhfnlqaassqgg
gydmrkllngtvvskhplksvtfvdnhdtqpgqslestvqtwfkplayafiltresgypq
vfygdmygtkgdsqreipalkhkiepilkarkq

SCOPe Domain Coordinates for d1e3xa2:

Click to download the PDB-style file with coordinates for d1e3xa2.
(The format of our PDB-style files is described here.)

Timeline for d1e3xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3xa1