Lineage for d1e3xa2 (1e3x A:1-393)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) 
Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins) 
Protein Bacterial alpha-amylase [51447] (5 species) Species Bacillus amyloliquefaciens/Bacillus licheniformis chimera [63903] (4 PDB entries) 
Domain d1e3xa2: 1e3x A:1-393 [59212]
Other proteins in same PDB: d1e3xa1
Details for d1e3xa2
PDB Entry: 1e3x (more details), 1.9 Å
PDB Description: native structure of chimaeric amylase from b. amyloliquefaciens and b. licheniformis at 1.92a
SCOP Domain Sequences for d1e3xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3xa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus amyloliquefaciens/Bacillus licheniformis chimera}
vngtlmqyfewytpndgqhwkrlqndaehlsdigitavwippaykglsqsdngygpydly
dlgefqqkgtvrtkygtkselqdaigslhsrnvqvygdvvlnhkagadatedvtavevnp
anrnqetseeyqikawtdfrfpgrgntysdfkwhwyhfdgadwdesrkisrifkfrgegk
awdwevssengnydylmyadvdydhpdvvaetkkwgiwyanelsldgfridaakhikfsf
lrdwvqavrqatgkemftvaeywqnnagklenylnktsfnqsvfdvplhfnlqaassqgg
gydmrkllngtvvskhplksvtfvdnhdtqpgqslestvqtwfkplayafiltresgypq
vfygdmygtkgdsqreipalkhkiepilkarkq
SCOP Domain Coordinates for d1e3xa2:
Click to download the PDB-style file with coordinates for d1e3xa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e3xa2:
- d1e3xa2 is new in SCOP 1.57
- d1e3xa2 appears in SCOP 1.59
- d1e3xa2 appears in the current release, SCOPe 2.08
View in 3D
